PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00053347-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family LFY
Protein Properties Length: 412aa    MW: 47066.5 Da    PI: 8.309
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00053347-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY573.74.8e-17514101386
           FLO_LFY   1 mdpeafsaslfkwdpraaaaapp..........arlleeaavseapleaaaaaaarklr....eleelfkayGvryltvakiaelGftvstLv 79 
                       mdpe+fsa++fkwd+ra a app          +r+++++ v++a+++++a++++ ++r    +leelf++yGvry+t++k++++Gftv+tLv
  PSME_00053347-RA   1 MDPESFSAAFFKWDQRASALAPPqmqrvggleaQRVFHDFGVPNAAAATMASNNSISCRkelnCLEELFRNYGVRYITLTKMVDMGFTVNTLV 93 
                       9*************9999877666888888888999999999888855555444444444555****************************** PP

           FLO_LFY  80 dmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkll.....sedeetaldalsqeglseepvqeekeaags.... 163
                       +m+++elddl+++l++i+r++llvGe+yGik+a+rae+rrlee+e +++ + ++      + +e+ald+lsqegls e+ q  +    s    
  PSME_00053347-RA  94 NMTEQELDDLIRTLVDIYRVELLVGEKYGIKSAIRAEKRRLEEAERKRMEQLFVdvdgkRKIDENALDTLSQEGLSVEEPQGDNAIILSqnnt 186
                       *******************************************98655555555666543334669********8866555533333331122 PP

           FLO_LFY 164 .....................ggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfiv 235
                                             + g++ ++l++++++++ +e                    + + +++++ + +++sgedgeerqrehPfiv
  PSME_00053347-RA 187 sasfplnlnagidpvlilqnnCHLGTAVSGLIGMPDTNYGSE--------------------QTKTSKKQKRRRSKDSGEDGEERQREHPFIV 259
                       233444333333333333332222222333333333333333....................33334444445556799************** PP

           FLO_LFY 236 tepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafke 328
                       tepge+argkknGLDYLfdLyeqC++fL++vq+iakerGekcPtkvtnqvfr+ak++ga yinkPkmrhYvhCYalhcLd e+sn+lrra+ke
  PSME_00053347-RA 260 TEPGELARGKKNGLDYLFDLYEQCGKFLMDVQHIAKERGEKCPTKVTNQVFRHAKHSGAGYINKPKMRHYVHCYALHCLDVEQSNRLRRAYKE 352
                       ********************************************************************************************* PP

           FLO_LFY 329 rgenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                       rgenvGawrqacy+plva+a+++gwdi++vfn+h++L+iWYvPtkLrqLCh e+sk+s
  PSME_00053347-RA 353 RGENVGAWRQACYYPLVAMAKDNGWDIEGVFNKHEKLRIWYVPTKLRQLCHFEKSKQS 410
                       *******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016987.0E-1491408IPR002910Floricaula/leafy protein
Gene3DG3DSA:1.10.238.108.5E-474160IPR011992EF-hand domain pair
Gene3DG3DSA:1.10.238.108.5E-4291323IPR011992EF-hand domain pair
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDPESFSAAF FKWDQRASAL APPQMQRVGG LEAQRVFHDF GVPNAAAATM ASNNSISCRK  60
ELNCLEELFR NYGVRYITLT KMVDMGFTVN TLVNMTEQEL DDLIRTLVDI YRVELLVGEK  120
YGIKSAIRAE KRRLEEAERK RMEQLFVDVD GKRKIDENAL DTLSQEGLSV EEPQGDNAII  180
LSQNNTSASF PLNLNAGIDP VLILQNNCHL GTAVSGLIGM PDTNYGSEQT KTSKKQKRRR  240
SKDSGEDGEE RQREHPFIVT EPGELARGKK NGLDYLFDLY EQCGKFLMDV QHIAKERGEK  300
CPTKVTNQVF RHAKHSGAGY INKPKMRHYV HCYALHCLDV EQSNRLRRAY KERGENVGAW  360
RQACYYPLVA MAKDNGWDIE GVFNKHEKLR IWYVPTKLRQ LCHFEKSKQS HL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A2e-982434104171FLORICAULA/LEAFY HOMOLOG 1
4bhk_B2e-982434104171FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7017630.0AY701763.1 Picea abies LEAFY-like protein (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002978027.11e-138hypothetical protein SELMODRAFT_417910
SwissprotO041160.0FLL_PINRA; Floricaula/leafy-like protein
TrEMBLA0A0K0M7C30.0A0A0K0M7C3_PINTB; LEAFY
STRINGEFJ206841e-137(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-113floral meristem identity control protein LEAFY (LFY)